Recombination Protein uvsY, Recombinant, Enterobacteria phage T4, aa1-137, His-Avi-Tag

Product Overview

• Article Name: Recombination Protein uvsY, Recombinant, Enterobacteria phage T4, aa1-137, His-Avi-Tag
• Biozol Catalog Number: USB-586137
• Supplier Catalog Number: 586137
• Alternative Catalog Number: USB-586137-20, USB-586137-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Plays a role in viral DNA synthesis by promoting enzymatic activities of UvsX recombinase, by promoting UvsX-ssDNA filament assembly, and by helping UvsX to displace bound gp32 from ssDNA. Source: Recombinant protein corresponding to aa1-137 from Enterobacteria phage T4 Recombination protein uvsY, fused to 6X His-Avi-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~21.7kD Amino Acid Sequence: MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 21.7
• UniProt: P04537
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.