Secretoglobin Family 1C Member 1, Recombinant, Mouse, aa24-95, His-SUMO-Tag

Produktübersicht

• Artikelname: Secretoglobin Family 1C Member 1, Recombinant, Mouse, aa24-95, His-SUMO-Tag
• Artikelnummer: USB-586258
• Hersteller Artikelnummer: 586258
• Alternativnummer: USB-586258-20,USB-586258-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa24-95 from mouse Secretoglobin family 1C member 1, 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~21.2kD Amino Acid Sequence: EDDNEFFMEFLQTLLVGTPEELYEGPLGKYNVNDMAKSALRELKSCIDELQPVHKEQLVKLLVQVLDAQEDT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 21.2
• UniProt: Q7M742
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.