Secretoglobin Family 1C Member 1, Recombinant, Mouse, aa24-95, His-SUMO-Tag

Product Overview

• Article Name: Secretoglobin Family 1C Member 1, Recombinant, Mouse, aa24-95, His-SUMO-Tag
• Biozol Catalog Number: USB-586258
• Supplier Catalog Number: 586258
• Alternative Catalog Number: USB-586258-20,USB-586258-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa24-95 from mouse Secretoglobin family 1C member 1, 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~21.2kD Amino Acid Sequence: EDDNEFFMEFLQTLLVGTPEELYEGPLGKYNVNDMAKSALRELKSCIDELQPVHKEQLVKLLVQVLDAQEDT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 21.2
• UniProt: Q7M742
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.