Toxin CfTx-1, Recombinant, Chironex fleckeri, aa145-456, His-SUMO-Tag

Artikelnummer: USB-586534
Artikelname: Toxin CfTx-1, Recombinant, Chironex fleckeri, aa145-456, His-SUMO-Tag
Artikelnummer: USB-586534
Hersteller Artikelnummer: 586534
Alternativnummer: USB-586534-20,USB-586534-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May cause profound effects on the cardiovascular system of anesthetized rats (at 25 ug/kg), since the fraction containing this toxin and CfTX-2 produces an initial increase in mean arterial pressure, followed by cardiovascular collapse in all animals within 1 minute of injection. To note, the same fraction does not induce significant change in heart rate. Has weak hemolytic activity. Is lethal to crayfish. Causes cutaneous inflammation in humans. May act as a pore-forming toxin, disrupting normal transmembrane ion concentration gradients in susceptible cells. Source: Recombinant protein corresponding to aa145-456 from Chironex fleckeri Toxin CfTx-1, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~52.2kD Amino Acid Sequence: EQSDQELQEALYGVKREYAVSKAFLDGVRNETSDLSPTEVSALAANVPIYQGVRFIAMVVQRIKYIKPKTESEIKRMLTMLELFTDLCSLRDLILLDLYQLVATPGHSPNIASGIKEVSNLGREEYKKVFEDLLKNDDKETYLFLSYLYPREKNEQSRKIFNFFDLMKVKYDDRLKQDLTGVKIFSNVHWPNYFMCSSNDYLALICTKPYGSLKLDKLNDGYYSIKTTQHDPKICHRYGNYILFTHKRNDDLEKFNFVPVKLEKREIYLLSSKESPNKFAYVPQNADGALFFVDGIPSKVGYGNQGYFTLVE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 52.2
UniProt: A7L035
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.