Tumor-associated Calcium Signal Transducer 2, Recombinant, Human, aa27-274, hFc-Tag

Artikelnummer: USB-586676
Artikelname: Tumor-associated Calcium Signal Transducer 2, Recombinant, Human, aa27-274, hFc-Tag
Artikelnummer: USB-586676
Hersteller Artikelnummer: 586676
Alternativnummer: USB-586676-20, USB-586676-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May function as a growth factor receptor. Source: Recombinant protein corresponding to aa27-274 from human Tumor-associated calcium signal transducer 2, fused to hFc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~56.8kD Amino Acid Sequence: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 56.8
UniProt: P09758
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.