Tumor-associated Calcium Signal Transducer 2, Recombinant, Human, aa27-274, hFc-Tag

Product Overview

• Article Name: Tumor-associated Calcium Signal Transducer 2, Recombinant, Human, aa27-274, hFc-Tag
• Biozol Catalog Number: USB-586676
• Supplier Catalog Number: 586676
• Alternative Catalog Number: USB-586676-20,USB-586676-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May function as a growth factor receptor. Source: Recombinant protein corresponding to aa27-274 from human Tumor-associated calcium signal transducer 2, fused to hFc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~56.8kD Amino Acid Sequence: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 56.8
• UniProt: P09758
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.