MHC Class I Polypeptide-related Sequence A, Active, Recombinant, Human, hFc-Tag, aa23-308 (MICA)

Artikelnummer: USB-587014
Artikelname: MHC Class I Polypeptide-related Sequence A, Active, Recombinant, Human, hFc-Tag, aa23-308 (MICA)
Artikelnummer: USB-587014
Hersteller Artikelnummer: 587014
Alternativnummer: USB-587014-10,USB-587014-50
Hersteller: US Biological
Kategorie: Molekularbiologie
Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T-cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis. Partial recombinant protein corresponding to aa23-308 from human MHC class I polypeptide-related sequence A, fused to hFc-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~59.9kD Biological Activity: The ED50 as determined by its ability to bind Human N2DL2 in functional ELISA is less than 5ug/ml. Amino Acid Sequence: AEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 59.9
UniProt: Q29983
Reinheit: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Formulierung: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.