MHC Class I Polypeptide-related Sequence A, Active, Recombinant, Human, hFc-Tag, aa23-308 (MICA)
Biozol Catalog Number:
USB-587014
Supplier Catalog Number:
587014
Alternative Catalog Number:
USB-587014-10,USB-587014-50
Manufacturer:
US Biological
Category:
Molekularbiologie
Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T-cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis. Partial recombinant protein corresponding to aa23-308 from human MHC class I polypeptide-related sequence A, fused to hFc-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~59.9kD Biological Activity: The ED50 as determined by its ability to bind Human N2DL2 in functional ELISA is less than 5ug/ml. Amino Acid Sequence: AEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
