Sonic Hedgehog Protein, Active, Recombinant Mouse, aa25-198 (Shh)

Artikelnummer: USB-587039
Artikelname: Sonic Hedgehog Protein, Active, Recombinant Mouse, aa25-198 (Shh)
Artikelnummer: USB-587039
Hersteller Artikelnummer: 587039
Alternativnummer: USB-587039-10,USB-587039-50
Hersteller: US Biological
Kategorie: Molekularbiologie
Sonic hedgehog protein. Partial recombinant protein corresponding to aa25-198 from mouse Sonic hedgehog protein, expressed in E.coli. Molecular Weight: ~19.8kD Biological Activity: The ED50 as determined by its ability to bind Human BOC in functional ELISA is less than 90ug/ml. Amino Acid Sequence: CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 19.8
UniProt: Q62226
Reinheit: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Formulierung: Supplied as a lyophilized powder from 20mM PBS, pH 7.4, 1mM DTT. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.