Sonic Hedgehog Protein, Active, Recombinant Mouse, aa25-198 (Shh)
Biozol Catalog Number:
USB-587039
Supplier Catalog Number:
587039
Alternative Catalog Number:
USB-587039-10,USB-587039-50
Manufacturer:
US Biological
Category:
Molekularbiologie
Sonic hedgehog protein. Partial recombinant protein corresponding to aa25-198 from mouse Sonic hedgehog protein, expressed in E.coli. Molecular Weight: ~19.8kD Biological Activity: The ED50 as determined by its ability to bind Human BOC in functional ELISA is less than 90ug/ml. Amino Acid Sequence: CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.