beta-Endorphin, Rat, Control Peptide

Artikelnummer: USB-E2300-03A
Artikelname: beta-Endorphin, Rat, Control Peptide
Artikelnummer: USB-E2300-03A
Hersteller Artikelnummer: E2300-03A
Alternativnummer: USB-E2300-03A-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Control Peptide for E2300-03 Sequence (linear): YGGFMTSKSQTPLVTLFKNAIIKNAYKKGE Storage and Stability: Lyophilized powder may be stored at 4C for short-term only. Stable for 12 months at -20C. Reconstitute to nominal volume (see reconstitution instructions for peptides) and store at -20C. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.
Reinheit: 95+% HPLC, Mass Spec
Formulierung: Supplied as a white to off-white lyophilized powder.