Control Peptide for E2300-03 Sequence (linear): YGGFMTSKSQTPLVTLFKNAIIKNAYKKGE Storage and Stability: Lyophilized powder may be stored at 4C for short-term only. Stable for 12 months at -20C. Reconstitute to nominal volume (see reconstitution instructions for peptides) and store at -20C. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.
Purity:
95+% HPLC, Mass Spec
Form:
Supplied as a white to off-white lyophilized powder.
* VAT and and shipping costs not included. Errors and price changes excepted
