Neuropeptide Tyrosine, Human (Neuropeptide Y, NPY)

Produktübersicht

• Artikelname: Neuropeptide Tyrosine, Human (Neuropeptide Y, NPY)
• Artikelnummer: USB-N2176-62Z
• Hersteller Artikelnummer: N2176-62Z
• Alternativnummer: USB-N2176-62Z-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie
• Applikation: ELISA

Produktbeschreibung

Source: Synthetic peptide corresponding to YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQYNH2 of human neuropeptide Y. Molecular Weight: 4271.8amu Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing.. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 4271.8
• Reinheit: 97% (HPLC)
• Formulierung: Supplied as a liquid.