Neuropeptide Tyrosine, Human (Neuropeptide Y, NPY)

Catalog Number: USB-N2176-62Z
Article Name: Neuropeptide Tyrosine, Human (Neuropeptide Y, NPY)
Biozol Catalog Number: USB-N2176-62Z
Supplier Catalog Number: N2176-62Z
Alternative Catalog Number: USB-N2176-62Z-100
Manufacturer: US Biological
Category: Molekularbiologie
Application: ELISA
Source: Synthetic peptide corresponding to YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQYNH2 of human neuropeptide Y. Molecular Weight: 4271.8amu Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing.. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 4271.8
Purity: 97% (HPLC)
Form: Supplied as a liquid.