Recombinant Human Galectin-9 (LGALS9)(W309A)

Catalog Number: CSB-MP012895HU(F1)(M)D7
Article Name: Recombinant Human Galectin-9 (LGALS9)(W309A)
Biozol Catalog Number: CSB-MP012895HU(F1)(M)D7
Supplier Catalog Number: CSB-MP012895HU(F1)(M)d7
Alternative Catalog Number: CSB-MP012895HU(F1)(M)D7-1, CSB-MP012895HU(F1)(M)D7-100, CSB-MP012895HU(F1)(M)D7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Ecalectin,Tumor antigen HOM-HD-21
Molecular Weight: 42.1 kDa
Tag: C-terminal 10xHis-tagged
UniProt: O00182
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.67.
Source: Mammalian cell
Expression System: 1-355aa(W309A)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFH
Application Notes: Research Areas: Neuroscience