HPSE Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096929
Article Name: HPSE Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096929
Supplier Catalog Number: orb2096929
Alternative Catalog Number: BYT-ORB2096929-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HPSE
Conjugation: Biotin
Alternative Names: HPA, HPA1, HPR1, HSE1, HPSE1
HPSE Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 006656
UniProt: Q9Y251
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCSGLDLIFGL