Synthetic peptide located within the following region: RLHTDLDPGSKKIKYILSGDGAGTIFQINDVTGDIHAIKRLDREEKAEYT
Application Notes:
Application Notes: This is a synthetic peptide designed for use in combination with CDH8 Rabbit Polyclonal Antibody (orb579399). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings
* VAT and and shipping costs not included. Errors and price changes excepted
