Anti-GRN
Catalog Number:
ATA-AMAB91384
- Images (7)
| Article Name: | Anti-GRN |
| Biozol Catalog Number: | ATA-AMAB91384 |
| Supplier Catalog Number: | AMAb91384 |
| Alternative Catalog Number: | ATA-AMAB91384-100,ATA-AMAB91384-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CLN11, PCDGF, PGRN |
| granulin |
| Anti-GRN |
| Clonality: | Monoclonal |
| Concentration: | 0.7 |
| Clone Designation: | [CL5692] |
| Isotype: | IgG1 |
| NCBI: | 2896 |
| UniProt: | P28799 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | SCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GRN |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human prostate shows moderate granular cytoplasmic immunoreactivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows cytoplasmic immunoreactivity in both renal glomeruli and tubules. |
|
|
Immunohistochemical staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows absence of positivity in striated muscle fibers as expected (negative control). |
|
|
AMAb91384-100ul |
|
|
AMAb91384-100ul |
|
|
AMAb91384-100ul |
Product Guarantee and Expert Support
