SESN2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2097109
Article Name: SESN2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2097109
Supplier Catalog Number: orb2097109
Alternative Catalog Number: BYT-ORB2097109-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SESN2
Conjugation: Biotin
Alternative Names: HI95, SES2, SEST2
SESN2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 113647
UniProt: P58004
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESL