Anti-COL20A1

Catalog Number: ATA-HPA060109
Article Name: Anti-COL20A1
Biozol Catalog Number: ATA-HPA060109
Supplier Catalog Number: HPA060109
Alternative Catalog Number: ATA-HPA060109-100,ATA-HPA060109-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1510
Clonality: Polyclonal
Concentration: 0,4
NCBI: 57642
UniProt: Q9P218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SLATLYQLVSQACESAIQTHVSKFDSFHENTRPPMPILEQKLEPGTEPLGSPGTRSKALVPGEWGRGGRHLEGRGEPGAVGQMGSPG
Target: COL20A1
HPA060109-100ul