Anti-MX1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-MX1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA049724
• Supplier Catalog Number: HPA049724
• Alternative Catalog Number: ATA-HPA049724-100,ATA-HPA049724-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: IFI-78K, MxA

Product Properties

• Clonality: Polyclonal
• NCBI: 4599
• UniProt: P20591
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: MEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLK
• Target: MX1