Recombinant Actinobacillus succinogenes Tryptophan synthase beta chain(trpB),Escherichia Coli Preis auf Anfrage

Catalog Number: CSB-EP407939AUG
Article Name: Recombinant Actinobacillus succinogenes Tryptophan synthase beta chain(trpB),Escherichia Coli Preis auf Anfrage
Biozol Catalog Number: CSB-EP407939AUG
Supplier Catalog Number: CSB-EP407939AUG
Alternative Catalog Number: CSB-EP407939AUG-1, CSB-EP407939AUG-100, CSB-EP407939AUG-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Recommended name: Tryptophan synthase beta chain EC= 4.2.1.20
Tag: The tag type will be determined during production process.
UniProt: A6VPD9
Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Source: E.coli
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: MSDTILNPYFGEFGGMYVPEILVPVLQQLEKAFVEARNDPDFQQEFQDLLKNYAGRPTAL TLCRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT ALACAMLDMPCRVYMGSKDVERQSPNVFRMRLMGTEVVPVEKGSCSLKDACCEAMRDWSA NYENTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQILEKEGCLPDAVIAAVGGGSNAIG MFTDFIDETNV
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.