[KO Validated] Fatty Acid Synthase (FASN) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A21398
Artikelname: [KO Validated] Fatty Acid Synthase (FASN) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A21398
Hersteller Artikelnummer: A21398
Alternativnummer: ABB-A21398-1000UL,ABB-A21398-200UL,ABB-A21398-50UL,ABB-A21398-20UL,ABB-A21398-100UL,ABB-A21398-500UL,ABB-A21398-5UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2221-2511 of human Fatty Acid Synthase (FASN) (NP_004095.4).
Konjugation: Unconjugated
Alternative Synonym: FAS, OA-519, SDR27X1, N)
The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this pr
Klonalität: Polyclonal
Molekulargewicht: 273kDa
NCBI: 2194
UniProt: P49327
Quelle: Rabbit
Reinheit: Affinity purification
Sequenz: SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSV
Target-Kategorie: FASN
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000
Anwendungsbeschreibung: Cross-reactivity: Human,Rat, Research area: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Tumor biomarkers,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,AMPK Signaling Pathway,Neuroscience,Cardiovascular,Lipids,Fatty Acids