[KO Validated] Fatty Acid Synthase (FASN) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21398
Article Name: [KO Validated] Fatty Acid Synthase (FASN) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21398
Supplier Catalog Number: A21398
Alternative Catalog Number: ABB-A21398-1000UL,ABB-A21398-200UL,ABB-A21398-50UL,ABB-A21398-20UL,ABB-A21398-100UL,ABB-A21398-500UL,ABB-A21398-5UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2221-2511 of human Fatty Acid Synthase (FASN) (NP_004095.4).
Conjugation: Unconjugated
Alternative Names: FAS, OA-519, SDR27X1, N)
The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this pr
Clonality: Polyclonal
Molecular Weight: 273kDa
NCBI: 2194
UniProt: P49327
Source: Rabbit
Purity: Affinity purification
Sequence: SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSV
Target: FASN
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000
Application Notes: Cross-reactivity: Human,Rat, Research area: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Tumor biomarkers,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,AMPK Signaling Pathway,Neuroscience,Cardiovascular,Lipids,Fatty Acids