Rbfox2 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: Rbfox2 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324719
• Supplier Catalog Number: orb324719
• Alternative Catalog Number: BYT-ORB324719-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rbfox2
• Conjugation: Unconjugated
• Alternative Names: anti 2810460A15Rik antibody, anti AA407676 antibody, anti AI118529 antibody, anti Fbm2 antibody, anti Fxh antibody, anti Hrnbp2 antibody, anti Rbm9 antibody

Product Description

Rabbit polyclonal antibody to Rbfox2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 47kDa
• NCBI: 001104297
• UniProt: Q8BP71
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE
• Target: Rbfox2

Images

Sample Type: NIH-3T3 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.