JARID1A (Jumonji/ARID Domain-containing Protein 1A, Retinoblastoma-binding Protein 2, RBBP-2, JARID1A, RBBP2, RBP2, KDM5A) (FITC), Clone: [1H2], Mouse, Monoclonal

Catalog Number: USB-128678-FITC
Article Name: JARID1A (Jumonji/ARID Domain-containing Protein 1A, Retinoblastoma-binding Protein 2, RBBP-2, JARID1A, RBBP2, RBP2, KDM5A) (FITC), Clone: [1H2], Mouse, Monoclonal
Biozol Catalog Number: USB-128678-FITC
Supplier Catalog Number: 128678-FITC
Alternative Catalog Number: USB-128678-FITC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Partial recombinant corresponding to aa191-291, from JARID1A (NP_005047) with GST tag. MW of the GST tag alone is 26kD.
The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein which regulates cell proliferation. This protein also interacts with rhombotin-2 which functions distinctly in erythropoiesis and in T-cell leukemogenesis. Rhombotin-2 is thought to either directly affect the activity of the encoded protein or may indirectly modulate the functions of the retinoblastoma protein by binding to this protein. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [1H2]
NCBI: 005056
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).