KLRC1 (Killer Cell Lectin-like Receptor Subfamily C Member 1, CD159 Antigen-like Family Member A, CD159a, NK Cell Receptor A, NKG2A, NKG2, NKG2-A/B-activating NK Receptor, NKG2-A/NKG2-B Type II Integral Membrane Protein, MGC13374,

Catalog Number: USB-128899
Article Name: KLRC1 (Killer Cell Lectin-like Receptor Subfamily C Member 1, CD159 Antigen-like Family Member A, CD159a, NK Cell Receptor A, NKG2A, NKG2, NKG2-A/B-activating NK Receptor, NKG2-A/NKG2-B Type II Integral Membrane Protein, MGC13374,
Biozol Catalog Number: USB-128899
Supplier Catalog Number: 128899
Alternative Catalog Number: USB-128899-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, IP
Immunogen: Partial recombinant corresponding to aa1-70 from human KLRC1 (NP_998823) with GST tag. MW of the GST tag alone is 26kD.
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed. Applications: Suitable for use in ELISA and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [2C3]
NCBI: 213658
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.