LRP1 (Prolow-density Lipoprotein Receptor-related Protein 1, LRP-1, Alpha-2-macroglobulin Receptor, A2MR, Apolipoprotein E Receptor, APOER, CD91, A2MR, APR), Mouse

Catalog Number: USB-129204
Article Name: LRP1 (Prolow-density Lipoprotein Receptor-related Protein 1, LRP-1, Alpha-2-macroglobulin Receptor, A2MR, Apolipoprotein E Receptor, APOER, CD91, A2MR, APR), Mouse
Biozol Catalog Number: USB-129204
Supplier Catalog Number: 129204
Alternative Catalog Number: USB-129204-50
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: IF, IHC, WB
Immunogen: Full length human LRP1, aa1-292 (AAH45107.1).
Endocytic receptor involved in endocytosis and in phagocytosis of apoptotic cells. Required for early embryonic development. Involved in cellular lipid homeostasis. Involved in the plasma clearance of chylomicron remnants and activated LRPAP1 (alpha 2-macroglobulin), as well as the local metabolism of complexes between plasminogen activators and their endogenous inhibitors. May modulate cellular events, such as APP metabolism, kinase-dependent intracellular signaling, neuronal calcium signaling as well as neurotransmission. Functions as a receptor for Pseudomonas aeruginosa exotoxin A Applications: Suitable for use in Immunofluorescence, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 045107
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.