LYPLA1 (APT1, LPL1, Acyl-protein Thioesterase 1, Lysophospholipase 1, Lysophospholipase I) (HRP), Clone: [3D5], Mouse, Monoclonal

Catalog Number: USB-129266-HRP
Article Name: LYPLA1 (APT1, LPL1, Acyl-protein Thioesterase 1, Lysophospholipase 1, Lysophospholipase I) (HRP), Clone: [3D5], Mouse, Monoclonal
Biozol Catalog Number: USB-129266-HRP
Supplier Catalog Number: 129266-HRP
Alternative Catalog Number: USB-129266-HRP-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Partial recombinant corresponding to aa66-151 from LYPLA1 (AAH08652) with GST tag. MW of the GST tag alone is 26kD.
Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRAS Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [3D5]
NCBI: 008652
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).