NOS2 (NOS2A, Nitric Oxide Synthase, Inducible, Hepatocyte NOS, Inducible NO Synthase, NOS Type II, Peptidyl-cysteine S-nitrosylase NOS2) (PE), Clone: [2G4], Mouse, Monoclonal

Catalog Number: USB-130473-PE
Article Name: NOS2 (NOS2A, Nitric Oxide Synthase, Inducible, Hepatocyte NOS, Inducible NO Synthase, NOS Type II, Peptidyl-cysteine S-nitrosylase NOS2) (PE), Clone: [2G4], Mouse, Monoclonal
Biozol Catalog Number: USB-130473-PE
Supplier Catalog Number: 130473-PE
Alternative Catalog Number: USB-130473-PE-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Partial recombinant corresponding to aa685-795 from human NOS2 (NP_000616) with GST tag. MW of the GST tag alone is 26kD.
Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDG Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2G4]
NCBI: 000625
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).