PARK2 (E3 Ubiquitin-protein Ligase Parkin, PRKN, Parkinson Juvenile Disease Protein 2, Parkinson Disease Protein 2) (APC), Clone: [1H4], Mouse, Monoclonal

Catalog Number: USB-130883-APC
Article Name: PARK2 (E3 Ubiquitin-protein Ligase Parkin, PRKN, Parkinson Juvenile Disease Protein 2, Parkinson Disease Protein 2) (APC), Clone: [1H4], Mouse, Monoclonal
Biozol Catalog Number: USB-130883-APC
Supplier Catalog Number: 130883-APC
Alternative Catalog Number: USB-130883-APC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, IF, WB
Immunogen: Partial recombinant corresponding to aa288-388 from human PARK2 (AAH22014) with GST tag. MW of the GST tag alone is 26kD.
Parkinson is the second most common neurodegenerative disease after Alzheimers. About 1 percent of people over the age of 65 and 3 percent of people over the age of 75 are affected by the disease. The mutation is the most common cause of Parkinson disease identified to date. The function of Park2 is not well-known, however, it may play a role in the ubiquitin-mediated proteolytic pathway. Mutations in this gene are known to cause autosomal recessive juvenile parkinsonism. Alternative splicing of this gene produces three known products of undetermined function. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [1H4]
NCBI: 022014
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).