PLP1 (Myelin Proteolipid Protein, PLP, Lipophilin) (Biotin), Clone: [2D7], Mouse, Monoclonal

Catalog Number: USB-131491-BIOTIN
Article Name: PLP1 (Myelin Proteolipid Protein, PLP, Lipophilin) (Biotin), Clone: [2D7], Mouse, Monoclonal
Biozol Catalog Number: USB-131491-BIOTIN
Supplier Catalog Number: 131491-Biotin
Alternative Catalog Number: USB-131491-BIOTIN-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, IF, WB
Immunogen: Partial recombinant protein corresponding to aa177-232 from human PLP1 with GST tag. MW of the GST tag alone is 26kD.
PLP encodes the major protein components of compact CNS myelin and mutations in the PLP gene can lead to severe dysmyelinating disease. Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: YFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAE Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2D7]
NCBI: 000533
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.