PZR (Myelin Protein Zero-like Protein 1, Protein Zero-related, MPZL1, UNQ849/PRO1787) (FITC), Rabbit
Biozol Catalog Number:
USB-132140-FITC
Supplier Catalog Number:
132140-FITC
Alternative Catalog Number:
USB-132140-FITC-100
Manufacturer:
US Biological
Host:
Rabbit
Category:
Antikörper
Application:
WB
Immunogen:
Full length human MPZL1, aa1-269 (NP_003944.1).
PZR (Protein zero related) is an immunoglobulin superfamily protein that specifically binds the tyrosine phosphatase SHP-2 through its intracellular immunoreceptor tyrosine-based inhibitory motifs (ITIMs). PZR is phosphorylated by c-Src, c-Fyn, c-Lyn, Csk, and c-Abl. PP1, a Src family kinase inhibitor, inhibits PZR phosphorylation. There are three alternatively spliced isoforms designated as PZR, PZRa, and PZRb, both PZRa and PZRb lack ITIMs. PZR is a main receptor of ConA and has an important role in cell signaling via c-Src. PZR is expressed in many cell types and is localized to cell contacts and intracellular granules in BAECs and mesothelioma (REN) cells. Recently, PZR has been implicated as a cell adhesion protein that may be involved in SHP-2-dependent signaling at interendothelial cell contacts. Hypertyrosine phosphorylation of PZR was observed during embryogenesis in a mouse model of Noonan Syndrome. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
