IL1A (Interleukin 1, alpha, IL-1A, IL1, IL1-ALPHA, IL1F1), Clone: [4C6], Mouse, Monoclonal

Catalog Number: USB-247551
Article Name: IL1A (Interleukin 1, alpha, IL-1A, IL1, IL1-ALPHA, IL1F1), Clone: [4C6], Mouse, Monoclonal
Biozol Catalog Number: USB-247551
Supplier Catalog Number: 247551
Alternative Catalog Number: USB-247551-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, IF, WB
Immunogen: IL1A (AAH13142, 172aa-271aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimers disease. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [4C6]
NCBI: 13142
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.4.