KCNK1 (Potassium Channel, Subfamily K, Member 1, DPK, HOHO, K2p1.1, KCNO1, TWIK-1, TWIK1) (HRP), Clone: [4D7], Mouse, Monoclonal

Catalog Number: USB-247821-HRP
Article Name: KCNK1 (Potassium Channel, Subfamily K, Member 1, DPK, HOHO, K2p1.1, KCNO1, TWIK-1, TWIK1) (HRP), Clone: [4D7], Mouse, Monoclonal
Biozol Catalog Number: USB-247821-HRP
Supplier Catalog Number: 247821-HRP
Alternative Catalog Number: USB-247821-HRP-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: KCNK1 (NP_002236.1, 265aa-336aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [4D7]
NCBI: 002236
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).