QPRT (Quinolinate Phosphoribosyltransferase, QPRTase), Mouse

Catalog Number: USB-250759
Article Name: QPRT (Quinolinate Phosphoribosyltransferase, QPRTase), Mouse
Biozol Catalog Number: USB-250759
Supplier Catalog Number: 250759
Alternative Catalog Number: USB-250759-50
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: WB
Immunogen: QPRT (AAH05060, 1aa-297aa) full-length human protein.
This gene encodes a key enzyme in catabolism of quinolinate, an intermediate in the tryptophan-nicotinamide adenine dinucleotide pathway. Quinolinate acts as a most potent endogenous exitotoxin to neurons. Elevation of quinolinate levels in the brain has been linked to the pathogenesis of neurodegenerative disorders such as epilepsy, Alzheimers disease, and Huntingtons disease. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGILAGQPFFDAIFTQLNCQVSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASMouse polyclonal antibody raised against a full-length human QPRT protein.AAVEAARGAGWTGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGGVEKAVRAARQAADFALKVEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 05060
Purity: Purified
Form: Supplied as a liquid. No preservative added.