CD46 (CD46 Molecule, Complement Regulatory Protein, Membrane Cofactor Protein, AHUS2, MCP, MIC10, TLX), Rabbit

Catalog Number: USB-352767
Article Name: CD46 (CD46 Molecule, Complement Regulatory Protein, Membrane Cofactor Protein, AHUS2, MCP, MIC10, TLX), Rabbit
Biozol Catalog Number: USB-352767
Supplier Catalog Number: 352767
Alternative Catalog Number: USB-352767-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: Synthetic peptide corresponding to aa46-76, ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK of mouse CD46 at N-terminal.
CD46 complement regulatory protein, also known as CD46 (cluster of differentiation 46) and Membrane Cofactor Protein, is a protein which in humans is encoded by the CD46 gene. The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. And the encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
UniProt: 088174
Purity: Purified by immunoaffinity chromatography.
Form: Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.