TMSB15A (Thymosin-like Protein 8, TMSL8, TMSNB, Tb15, TbNB), Clone: [6D10], Mouse, Monoclonal

Product Overview

• Article Name: TMSB15A (Thymosin-like Protein 8, TMSL8, TMSNB, Tb15, TbNB), Clone: [6D10], Mouse, Monoclonal
• Biozol Catalog Number: USB-368357
• Supplier Catalog Number: 368357
• Alternative Catalog Number: USB-368357-100
• Manufacturer: US Biological
• Host: Mouse
• Category: Antikörper
• Application: ELISA, WB
• Immunogen: TMSB15A (NP_068832.1, aa1-45) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Product Description

Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [6D10]
• NCBI: 068832
• UniProt: P0CG34
• Purity: Purified
• Form: Supplied as a liquid in PBS, pH 7.4.