Anti-SUR2B [N323B/20], Mouse IgG2a, kappa, Monoclonal

Product Overview

• Article Name: Anti-SUR2B [N323B/20], Mouse IgG2a, kappa, Monoclonal
• Biozol Catalog Number: ABA-AB02169-2.0-BT
• Supplier Catalog Number: Ab02169-2.0-BT
• Alternative Catalog Number: ABA-AB02169-2.0-BT
• Manufacturer: Absolute Antibody
• Host: Mouse
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Rat
• Alternative Names: N323B/20R, ATP-binding cassette sub-family C member 9, Abcc9, Sulfonylurea receptor 2

Product Description

This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [N323B/20]
• Isotype: IgG2a
• UniProt: Q63563
• Buffer: PBS only.
• Source: Mouse
• Target: SUR2B
• Antibody Type: Recombinant Antibody