Anti-Caspase-3 [4F-6], Human IgG1, kappa, Monoclonal
Catalog Number:
ABA-AB04219-10.0
| Article Name: |
Anti-Caspase-3 [4F-6], Human IgG1, kappa, Monoclonal |
| Biozol Catalog Number: |
ABA-AB04219-10.0 |
| Supplier Catalog Number: |
Ab04219-10.0 |
| Alternative Catalog Number: |
ABA-AB04219-10.0 |
| Manufacturer: |
Absolute Antibody |
| Host: |
Human |
| Category: |
Antikörper |
| Application: |
ELISA, NeA, WB |
| Species Reactivity: |
Human |
| Alternative Names: |
CASP-3, CPP-32, SCA-1, EC:3.4.22.56, Apopain, Cysteine protease CPP32, Protein Yama |
| The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC. |
| Clonality: |
Monoclonal |
| Clone Designation: |
[4F-6] |
| Isotype: |
IgG1 |
| UniProt: |
P42574 |
| Buffer: |
PBS with 0.02% Proclin 300. |
| Target: |
Caspase-3 |
