Anti-Phospholipase A2 [AbAb01-PLA2], Camelid VHH, His-tagged,, Camelus, Monoclonal

Product Overview

• Article Name: Anti-Phospholipase A2 [AbAb01-PLA2], Camelid VHH, His-tagged,, Camelus, Monoclonal
• Biozol Catalog Number: ABA-AB04530-34.11-BS
• Supplier Catalog Number: Ab04530-34.11-BS
• Alternative Catalog Number: ABA-AB04530-34.11-BS
• Manufacturer: Absolute Antibody
• Host: Camelus
• Category: Antikörper
• Application: ELISA
• Alternative Names: PLA2, Snake venom phospholipase A2, Phospholipase A2 5

Product Description

A chimeric protein was generated by combining the linear epitopes of three main toxins (phospholipase A2 [PLA2], snake venom metalloproteinase [SVMP] and 3 finger toxin [3FT]) of the snake venoms of Najanajaatra, Ophiophagus hannah and Bungarus fasciatus. The chimeric protein was conjugated with KLH to form the immunogen which was used to immunize alpacas to generated this antibody. The actual sequence of the chimeric protein used for immunization was YCGPGGTGTPLDGGCDRAAAICFAAAPYGGKPDITCTGAKGSCGGGGKLTCKADNDECAAFGGSGGTITCNADNDEGGSQGTLTCKGGNNA.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [AbAb01-PLA2]
• Buffer: PBS only.
• Target: Phospholipase A2