A chimeric protein was generated by combining the linear epitopes of three main toxins (phospholipase A2 [PLA2], snake venom metalloproteinase [SVMP] and 3 finger toxin [3FT]) of the snake venoms of Najanajaatra, Ophiophagus hannah and Bungarus fasciatus. The chimeric protein was conjugated with KLH to form the immunogen which was used to immunize alpacas to generate this antibody. The actual sequence of the chimeric protein used for immunization was YCGPGGTGTPLDGGCDRAAAICFAAAPYGGKPDITCTGAKGSCGGGGKLTCKADNDECAAFGGSGGTITCNADNDEGGSQGTLTCKGGNNA.
Clonality:
Monoclonal
Clone Designation:
[AbAb02-PLA2]
Buffer:
PBS with 0.02% Proclin 300.
Target:
Phospholipase A2
* VAT and and shipping costs not included. Errors and price changes excepted