NQO1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0047
Article Name: NQO1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0047
Supplier Catalog Number: A0047
Alternative Catalog Number: ABB-A0047-20UL,ABB-A0047-100UL,ABB-A0047-1000UL,ABB-A0047-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DTD, QR1, DHQU, DIA4, NMOR1, NMORI, NQO1
This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. This FAD-binding protein forms homodimers and reduces quinones to hydroquinones. This proteins enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimers disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Molecular Weight: 31kDa
NCBI: 1728
UniProt: P15559
Purity: Affinity purification
Sequence: MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLS
Target: NQO1
Application Dilute: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Signal Transduction,Endocrine Metabolism,Drug metabolism