Prohibitin Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Prohibitin Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A0056
• Supplier Catalog Number: A0056
• Alternative Catalog Number: ABB-A0056-20UL,ABB-A0056-500UL,ABB-A0056-100UL,ABB-A0056-1000UL,ABB-A0056-50UL,ABB-A0056-200UL,ABB-A0056-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-272 of human Prohibitin (NP_002625.1).
• Conjugation: Unconjugated
• Alternative Names: PHB, HEL-215, HEL-S-54e, Prohibitin

Product Description

This gene is evolutionarily conserved, and its product is proposed to play a role in human cellular senescence and tumor suppression. Antiproliferative activity is reported to be localized to the 3 UTR, which is proposed to function as a trans-acting reg

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 30kDa
• NCBI: 5245
• UniProt: P35232
• Source: Rabbit
• Purity: Affinity purification
• Sequence: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRS
• Target: PHB1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
• Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell cycle inhibitors,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers