Prohibitin Rabbit pAb, Unconjugated

Catalog Number: ABB-A0056
Article Name: Prohibitin Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0056
Supplier Catalog Number: A0056
Alternative Catalog Number: ABB-A0056-100UL,ABB-A0056-20UL,ABB-A0056-500UL,ABB-A0056-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PHB, HEL-215, HEL-S-54e, Prohibitin
This gene is evolutionarily conserved, and its product is proposed to play a role in human cellular senescence and tumor suppression. Antiproliferative activity is reported to be localized to the 3 UTR, which is proposed to function as a trans-acting regulatory RNA. Several pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 5245
UniProt: P35232
Purity: Affinity purification
Sequence: PRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
Target: PHB1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell cycle inhibitors,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers