CYP1A2 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0062
Article Name: CYP1A2 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0062
Supplier Catalog Number: A0062
Alternative Catalog Number: ABB-A0062-100UL,ABB-A0062-20UL,ABB-A0062-500UL,ABB-A0062-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CP12, CYPIA2, P3-450, P450(PA), CYP1A2
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzymes endogenous substrate is unknown, however, it is able to metabolize some PAHs to carcinogenic intermediates. Other xenobiotic substrates for this enzyme include caffeine, aflatoxin B1, and acetaminophen. The transcript from this gene contains four Alu sequences flanked by direct repeats in the 3 untranslated region.
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 1544
UniProt: P05177
Purity: Affinity purification
Sequence: FGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQE
Target: CYP1A2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Lipid Metabolism,Lipases,Drug metabolism,Cardiovascular,Lipids