GluR2/GRIA2 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0111
Article Name: GluR2/GRIA2 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0111
Supplier Catalog Number: A0111
Alternative Catalog Number: ABB-A0111-20UL,ABB-A0111-200UL,ABB-A0111-500UL,ABB-A0111-1000UL,ABB-A0111-100UL,ABB-A0111-50UL,ABB-A0111-5UL
Manufacturer: ABclonal
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-230 of human GluR2/GluR2/GRIA2 (NP_001077088.1).
Conjugation: Unconjugated
Alternative Names: GLUR2, GLURB, GluA2, HBGR2, NEDLIB, gluR-2, gluR-B, GluR-K2
Molecular Weight: 99kDa
NCBI: 2891
UniProt: P42262
Source: Rabbit
Purity: Affinity purification
Sequence: NSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHV
Target: GRIA2
Application Dilute: WB,1:500 - 1:1000
Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Dopamine Signaling in Parkinsons Disease