CD40 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0218
Article Name: CD40 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0218
Supplier Catalog Number: A0218
Alternative Catalog Number: ABB-A0218-20UL,ABB-A0218-100UL,ABB-A0218-500UL,ABB-A0218-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: p50, Bp50, CDW40, TNFRSF5, CD40
This gene is a member of the TNF-receptor superfamily. The encoded protein is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Mutations affecting this gene are the cause of autosomal recessive hyper-IgM immunodeficiency type 3 (HIGM3). Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 958
UniProt: P25942
Purity: Affinity purification
Sequence: IPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Target: CD40
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs,B Cell Receptor Signaling Pathway,NF-kB Signaling Pathway,Stem Cells,Hematopoietic Progenitors,Cardiovascular