C-Reactive Protein (CRP) Rabbit pAb, Unconjugated

Catalog Number: ABB-A0224
Article Name: C-Reactive Protein (CRP) Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0224
Supplier Catalog Number: A0224
Alternative Catalog Number: ABB-A0224-100UL,ABB-A0224-20UL,ABB-A0224-1000UL,ABB-A0224-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PTX1, C-Reactive Protein (CRP)
The protein encoded by this gene belongs to the pentraxin family which also includes serum amyloid P component protein and pentraxin 3. Pentraxins are involved in complement activation and amplification via communication with complement initiation pattern recognition molecules, but also complement regulation via recruitment of complement regulators. The encoded protein has a calcium dependent ligand binding domain with a distinctive flattened beta-jellyroll structure. It exists in two forms as either a pentamer in circulation or as a nonsoluble monomer in tissues. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. Elevated expression of the encoded protein is associated with severe acute respiratory syndrome coronavirus 2 (SARS&8208,CoV&8208,2) infection.
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 1401
UniProt: P02741
Purity: Affinity purification
Sequence: ILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSP
Target: CRP
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Endocrine and metabolic diseases,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience,Neurodegenerative Diseases Markers,Other Neurological disorders,Cardiovascular,Blood,Heart.