Cytokeratin 19 (KRT19) Rabbit PolymAb, Unconjugated

Catalog Number: ABB-A0247PM
Article Name: Cytokeratin 19 (KRT19) Rabbit PolymAb, Unconjugated
Biozol Catalog Number: ABB-A0247PM
Supplier Catalog Number: A0247PM
Alternative Catalog Number: ABB-A0247PM-100UL,ABB-A0247PM-20UL,ABB-A0247PM-500UL,ABB-A0247PM-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: K19, CK19, K1CS
The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.
Molecular Weight: 44kDa
NCBI: 3880
UniProt: P08727
Purity: Affinity purification
Sequence: TDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Target: KRT19
Application Dilute: WB,1:1000 - 1:10000|IF/ICC,1:200 - 1:800|IHC-P,1:4000 - 1:20000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Extracellular Matrix,Keratin,Stem Cells.
Western blot analysis of lysates from Rat lung using Cytokeratin 19 (KRT19) Rabbit PolymAb (A0247PM) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of lysates from Hep G2 cells using Cytokeratin 19 (KRT19) Rabbit PolymAb (A0247PM) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of lysates from Mouse lung using Cytokeratin 19 (KRT19) Rabbit PolymAb (A0247PM) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb (A0247PM) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb (A0247PM) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human hepatocholangiocarcinoma tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb (A0247PM) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb (A0247PM) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb (A0247PM) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Confocal imaging of paraffin-embedded Human pancreas tissue using Cytokeratin 19 (KRT19) Rabbit PolymAb (A0247PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.