PCNA Rabbit pAb, Unconjugated

Catalog Number: ABB-A0264
Article Name: PCNA Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0264
Supplier Catalog Number: A0264
Alternative Catalog Number: ABB-A0264-100UL,ABB-A0264-20UL,ABB-A0264-1000UL,ABB-A0264-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ATLD2, PCNA
The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 5111
UniProt: P12004
Purity: Affinity purification
Sequence: CAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Target: PCNA
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor biomarkers,Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Stem Cells